Protein Info for IAI47_18355 in Pantoea sp. MT58

Annotation: threonine export protein RhtC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 40 to 63 (24 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 125 to 141 (17 residues), see Phobius details amino acids 152 to 177 (26 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details PF01810: LysE" amino acids 14 to 206 (193 residues), 180.2 bits, see alignment E=1.7e-57 TIGR00949: homoserine/Threonine efflux protein" amino acids 18 to 203 (186 residues), 208.5 bits, see alignment E=3.5e-66

Best Hits

Swiss-Prot: 74% identical to RHTC_ECO57: Threonine efflux protein (rhtC) from Escherichia coli O157:H7

KEGG orthology group: K05835, threonine efflux protein (inferred from 98% identity to pva:Pvag_3415)

MetaCyc: 74% identical to L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-0244

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>IAI47_18355 threonine export protein RhtC (Pantoea sp. MT58)
MLMLFATVALVHLVALMSPGPDFFFVSQTAASRSRKEAMMGVLGITLGIVVWAGVALMGL
HLILEKMAWLHQIIMVGGGLYLLWMGWQLMCSARQRHKQPQQDEPVVELPKRGMSFLKGL
LTNLSNPKAIIYFGSVFSLFVGDDVGSAERWGLFLLIIGETFAWFALVAAIFALPWIRAK
YQRLAKWVDGMAGVLFAGFGIHLIISR