Protein Info for IAI47_18285 in Pantoea sp. MT58
Annotation: bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 88% identical to UBIE_ERWT9: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)
KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 100% identity to pva:Pvag_3430)MetaCyc: 84% identical to bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinol methylase and demethylmenaquinone methyltransferase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]; ADOMET-DMK-METHYLTRANSFER-RXN [EC: 2.1.1.201, 2.1.1.163]
Predicted SEED Role
"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)" in subsystem Menaquinone Biosynthesis via Futalosine or Menaquinone and Phylloquinone Biosynthesis or Ubiquinone Biosynthesis (EC 2.1.1.-)
MetaCyc Pathways
- superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
- ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
- superpathway of chorismate metabolism (44/59 steps found)
- menaquinol-4 biosynthesis I (1/1 steps found)
- menaquinol-6 biosynthesis (1/1 steps found)
- menaquinol-8 biosynthesis (1/1 steps found)
- menaquinol-9 biosynthesis (1/1 steps found)
- menaquinol-10 biosynthesis (1/2 steps found)
- menaquinol-11 biosynthesis (1/2 steps found)
- menaquinol-12 biosynthesis (1/2 steps found)
- menaquinol-13 biosynthesis (1/2 steps found)
- menaquinol-7 biosynthesis (1/2 steps found)
- ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
- ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
- ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
- ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
- ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
- ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
- ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
- ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
- superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
- superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
- ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
- superpathway of menaquinol-8 biosynthesis I (2/10 steps found)
- superpathway of menaquinol-8 biosynthesis II (2/10 steps found)
- superpathway of menaquinol-10 biosynthesis (1/10 steps found)
- superpathway of menaquinol-11 biosynthesis (1/10 steps found)
- superpathway of menaquinol-12 biosynthesis (1/10 steps found)
- superpathway of menaquinol-13 biosynthesis (1/10 steps found)
- superpathway of menaquinol-6 biosynthesis (1/10 steps found)
- superpathway of menaquinol-7 biosynthesis (1/10 steps found)
- superpathway of menaquinol-9 biosynthesis (1/10 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-
Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (252 amino acids)
>IAI47_18285 bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE (Pantoea sp. MT58) MADESQQETTHFGFQTVAKSEKADKVADVFHSVAAKYDLMNDLMSFGVHRIWKRFTIDSS GVRRGQRVLDLAGGTGDLTAKFSRLVGETGQVVLADINSSMLKMGREKLRNQGVVGNVSY VQANAEALPFPDNYFDCITISFGLRNVTEKEKALASMFRVLKPGGRLLVLEFSKPVLDPL SKAYDAYSFHILPRIGQLVAQDAESYRYLAESIRMHPDQETLKAMMNDVGFENTTYSNMT GGIVALHRGFKF