Protein Info for IAI47_18115 in Pantoea sp. MT58

Annotation: 50S ribosomal protein L7/L12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00855: ribosomal protein bL12
  • amino acids 1 to 120 (120 residues), 137.7 bits, E=1.4e-44
• PF16320: Ribosomal_L12_N
  • amino acids 4 to 48 (45 residues), 62.9 bits, E=1.8e-21
• PF00542: Ribosomal_L12
  • amino acids 55 to 120 (66 residues), 86.7 bits, E=1.1e-28

Best Hits

Swiss-Prot: 84% identical to RL7_PECAS: 50S ribosomal protein L7/L12 (rplL) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02935, large subunit ribosomal protein L7/L12 (inferred from 98% identity to pam:PANA_0214)

MetaCyc: 84% identical to 50S ribosomal subunit protein L12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L7/L12 (P1/P2)" in subsystem Ribosome LSU bacterial

Protein Sequence (120 amino acids)

>IAI47_18115 50S ribosomal protein L7/L12 (Pantoea sp. MT58)
MSITKDQILEAVAAMSVMEVVELVSAMEEKFGVSAAAAVAVAAGPAEAVEEKTEFDVVLK
AVGPNKVAVIKAVRTATGLGLKEAKDLVEATGVIKEAISKDDAAALEAALKEAGAEVEVK