Protein Info for IAI47_17915 in Pantoea sp. MT58

Annotation: phosphate-starvation-inducible protein PsiE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details PF06146: PsiE" amino acids 17 to 129 (113 residues), 81.2 bits, see alignment E=3.8e-27

Best Hits

Swiss-Prot: 76% identical to PSIE_ECO57: Protein PsiE (psiE) from Escherichia coli O157:H7

KEGG orthology group: K13256, protein PsiE (inferred from 98% identity to pva:Pvag_3509)

Predicted SEED Role

"PsiE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>IAI47_17915 phosphate-starvation-inducible protein PsiE (Pantoea sp. MT58)
MSDKNPLARHLATVLQWVLNLGLLSLAIILIVFLGKETIHLANVLFNTSEQASSYLLIDG
IVIYFLYFEFIALIVKYFQSGYHFPLRYFVYIGITAIIRLIIVDHKNPFDTLCYSAAILI
LVVTLWLANSNRLKRE