Protein Info for IAI47_17630 in Pantoea sp. MT58

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR01891: amidohydrolase" amino acids 16 to 417 (402 residues), 359.9 bits, see alignment E=8.2e-112 PF01546: Peptidase_M20" amino acids 113 to 428 (316 residues), 110.6 bits, see alignment E=9.9e-36 PF07687: M20_dimer" amino acids 232 to 317 (86 residues), 39.3 bits, see alignment E=5.6e-14

Best Hits

Swiss-Prot: 65% identical to ABGA_ECOLI: p-aminobenzoyl-glutamate hydrolase subunit A (abgA) from Escherichia coli (strain K12)

KEGG orthology group: K12940, aminobenzoyl-glutamate utilization protein A (inferred from 95% identity to pva:Pvag_3565)

MetaCyc: 65% identical to p-aminobenzoyl-glutamate hydrolase subunit A (Escherichia coli K-12 substr. MG1655)
3.5.1.-

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>IAI47_17630 amidohydrolase (Pantoea sp. MT58)
MRPLSEHVCALLPKLQQWRRDFHHYAESGWLEFRTATLVAEELHKLGYQLELGREVIDAD
ARMGLPDEAVLKQQEARALQQGALPQWISHFSGGFCGIVATLETGRPGPVMGFRVDMDAL
DLNESQADDHLPQREGFASCNAGMMHACAHDGHTTIGLGLASVLMAMKDELSGTIKLIFQ
PAEEGVRGAKAMVAAGAVDDVDRFTAIHIGTGVPAGEVVCGSDSFLATTKLDVHFTGVGA
HAGGRPEEGRNALLAAAQATLALHGLTQHSGGVARVNVGVLQAGTGRNVVADCALLKVET
RGVTNQVNDDIYQQALRVIDGAAAMYGVEQQVSLMGAARSCTPTQPWVDFIHQQADALGI
FDSVVDRKAQAAGSEDATYMMERVKQRGGQASYVIFGCELAAGHHNAKFDFDERVMPDAI
TLLATLALNQAQFGGSQ