Protein Info for IAI47_17585 in Pantoea sp. MT58

Annotation: glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 796 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 56 (18 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details TIGR03074: membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family" amino acids 14 to 793 (780 residues), 1154.4 bits, see alignment E=0 PF13360: PQQ_2" amino acids 198 to 380 (183 residues), 29 bits, see alignment E=1.3e-10 amino acids 675 to 776 (102 residues), 34.1 bits, see alignment E=3.4e-12 PF01011: PQQ" amino acids 227 to 262 (36 residues), 30.9 bits, see alignment (E = 2.3e-11) amino acids 292 to 322 (31 residues), 24.8 bits, see alignment (E = 2e-09) amino acids 359 to 390 (32 residues), 24.5 bits, see alignment (E = 2.6e-09) amino acids 445 to 471 (27 residues), 28 bits, see alignment (E = 1.9e-10) amino acids 668 to 702 (35 residues), 28.6 bits, see alignment (E = 1.3e-10) amino acids 725 to 759 (35 residues), 23.2 bits, see alignment (E = 6.7e-09)

Best Hits

Swiss-Prot: 72% identical to DHG_ECOLI: Quinoprotein glucose dehydrogenase (gcd) from Escherichia coli (strain K12)

KEGG orthology group: K00117, quinoprotein glucose dehydrogenase [EC: 1.1.5.2] (inferred from 73% identity to bph:Bphy_5562)

MetaCyc: 72% identical to quinoprotein glucose dehydrogenase (Escherichia coli K-12 substr. MG1655)
Quinoprotein glucose dehydrogenase. [EC: 1.1.5.2]

Predicted SEED Role

"Glucose dehydrogenase, PQQ-dependent (EC 1.1.5.2)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway or Respiratory dehydrogenases 1 (EC 1.1.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.5.2

Use Curated BLAST to search for 1.1.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (796 amino acids)

>IAI47_17585 glucose/quinate/shikimate family membrane-bound PQQ-dependent dehydrogenase (Pantoea sp. MT58)
MGKNSSSFGVIRFLTVLFAVLTGAFMLIGGGWLAAIGGSWYYVFGGVIMLITAYLLSRRK
STALVLYALLLIGTLIWGVWEVGTDFWALAPRTDVLVIFGVWLILPFVYRSFNAGSKAAL
GSMAVALIASAIVLAYAVFNDPQVINGSVPETADNAPQATPLSNIPDADWPAYARDQQGT
RFSPLKQINHQNVKELQVAWQFQTGDMKTPNDPGEITDEVTPIKIRDTLYLCSPHQILFA
LDAATGKQKWKFDPGMKVNPTFQHVTCRGVSYHEVPAAADAANTQPAICSRRIYLPVNDG
RLFALDAETGERCPSFGVNGELDLQHKQPVTTAGMYEPTSPPVITNTTIVMAGAVTDNFS
TREPSGVIRGFDVNTGKLLWVFDPGAKDPNAIPADEHTFTMNSPNSWAPAVYDPKLDTVY
LPMGVTTPDIWGGNRTPEQERYASSVLALNATTGKLVWSYQTVHHDLWDMDLPSQPTLAD
ITDKDGNTVPVVYAPAKTGNIFVLDRRTGKPVVPAPETPVPQGAAKGDHVAATQPYSELT
FRPKQNLTDKDMWGATMFDQLVCRVIFKRLRYEGPFTPPSEQGTLVFPGNLGMFEWGGIA
VDPNRQIAIANPMALPFVSKLVPRGPGNPIEPPKGAEGGSGTETGIQPQYGVPYGVELNP
FLSPFGLPCKQPAWGYVSAVDLKTNNVVWKQRIGTVRDSAPVPLPFKMGMPMLGGPVTTA
GKVFFIGATADNYLRAFSTDTGELLWEARLPAGGQATPMTYEVNGKQYVVIAAGGHGSFG
TKLGDYVIAYALPDQK