Protein Info for IAI47_17555 in Pantoea sp. MT58

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 121.8 bits, see alignment E=5.1e-39 PF17912: OB_MalK" amino acids 235 to 289 (55 residues), 48.9 bits, see alignment 1.5e-16 PF08402: TOBE_2" amino acids 282 to 355 (74 residues), 41 bits, see alignment E=2.5e-14

Best Hits

Swiss-Prot: 54% identical to LACK_RHIRD: Lactose transport ATP-binding protein LacK (lacK) from Rhizobium radiobacter

KEGG orthology group: K10111, maltose/maltodextrin transport system ATP-binding protein [EC: 3.6.3.19] (inferred from 98% identity to pva:Pvag_3581)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.19

Use Curated BLAST to search for 3.6.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>IAI47_17555 ABC transporter ATP-binding protein (Pantoea sp. MT58)
MTSLRLQNVKKSYEHVNVIHGIDLTINSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGQL
LIEEQDMTQQPATERGIAMVFQSYALYPNMTVRGNLAYPLEVMKKSKAEINEAIAQTAAR
LHLTELLDRLPRALSGGQRQRVAIGRAIIRHPRIFLFDEPLSNLDAELRLQMRIEIARLH
ASLGNTMIYVTHDQLEAMTLADRIVVLRQGRIEQVGAPLTLYHDPDNLFVAGFIGSPKMN
FLRAEISATGAGEVQLRVPELKIEGLVLKIAADCREGQTVTLGIRPEHFQPAAQTPDALR
FHGELAYGEMLGHTNYLYLDIGREQMLVVEEREATTRELGTQVELGFSAAHCLLFDEQGM
RLR