Protein Info for IAI47_17330 in Pantoea sp. MT58

Annotation: divalent cation tolerance protein CutA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 44 (19 residues), see Phobius details PF03091: CutA1" amino acids 5 to 101 (97 residues), 115 bits, see alignment E=5.9e-38

Best Hits

Swiss-Prot: 68% identical to CUTA_PECAS: Divalent-cation tolerance protein CutA (cutA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03926, periplasmic divalent cation tolerance protein (inferred from 91% identity to pva:Pvag_3606)

Predicted SEED Role

"Periplasmic divalent cation tolerance protein cutA" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (104 amino acids)

>IAI47_17330 divalent cation tolerance protein CutA (Pantoea sp. MT58)
MNAVVILCTAPDQATADHLAALALEARLAACVTLLPGATSWYLWQGKMEKSSEIQMLLKC
DSDHQQALCELLKEAHPYDVPELLALPVQHGDSEYLSWLHASLA