Protein Info for IAI47_17165 in Pantoea sp. MT58

Annotation: 3-deoxy-manno-octulosonate-8-phosphatase KdsC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 TIGR01670: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family" amino acids 26 to 179 (154 residues), 239.2 bits, see alignment E=8.6e-76 PF08282: Hydrolase_3" amino acids 95 to 158 (64 residues), 38.1 bits, see alignment E=7.7e-14

Best Hits

Swiss-Prot: 77% identical to KDSC_ECOL6: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC (kdsC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03270, 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC: 3.1.3.45] (inferred from 97% identity to pva:Pvag_3638)

MetaCyc: 77% identical to 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase monomer (Escherichia coli BL21(DE3))
3-deoxy-manno-octulosonate-8-phosphatase. [EC: 3.1.3.45]

Predicted SEED Role

"3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (EC 3.1.3.45)" in subsystem KDO2-Lipid A biosynthesis (EC 3.1.3.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>IAI47_17165 3-deoxy-manno-octulosonate-8-phosphatase KdsC (Pantoea sp. MT58)
MQQATPPIETCYGPVSADVMARASNIRLLICDVDGVMSDGVIYMGNNGEELKAFNVRDGY
GVRCLLTSDVEVAIITGRNARLMEDRCKTLGIRHLYQGQSDKLLAYRELLDKLSLSDDQV
AYIGDDLIDWPVMAKVGLSVAVADAHPILLPRAHYVTRIAGGRGAVREVCDLILMAQNKF
EDAKGQSV