Protein Info for IAI47_17155 in Pantoea sp. MT58

Annotation: calcium/sodium antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 68 to 93 (26 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 241 to 263 (23 residues), see Phobius details amino acids 277 to 293 (17 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 3 to 313 (311 residues), 308.6 bits, see alignment E=2.2e-96 PF01699: Na_Ca_ex" amino acids 6 to 144 (139 residues), 114.5 bits, see alignment E=2.2e-37 amino acids 176 to 318 (143 residues), 112.2 bits, see alignment E=1.2e-36

Best Hits

Swiss-Prot: 65% identical to YRBG_ECOLI: Inner membrane protein YrbG (yrbG) from Escherichia coli (strain K12)

KEGG orthology group: K07301, inner membrane protein (inferred from 98% identity to pva:Pvag_3640)

Predicted SEED Role

"Inner membrane protein YrbG, predicted calcium/sodium:proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>IAI47_17155 calcium/sodium antiporter (Pantoea sp. MT58)
MFLASALLIIGLLLLAYGADRLVFSASILCRSFGIPPLIIGMTVVSIGTSLPEMILSFSA
AQHGQMDLAVGTALGSNITNILLILGAAALMHPLYVHSNLIRRELPLMLLVTLLSGFMLF
DNQLSRLDGIGLIAIAAIYLMVVIRIARKAEQDNNDTLTREQLAELPREESGNTVAFLWL
AVALIILPMSTRMVIDNATAFADYFGVSELVMGLTLIAVGTSLPELATVIAGALKGEDDI
AIGNLIGANIYNIAIVLGLPALIHPGSIDYHAFARDYWVMLGVSVLFALLCLLRRRRVGR
TAGLILLCGFFVWVTLLWMQPAFMDG