Protein Info for IAI47_17095 in Pantoea sp. MT58

Annotation: 50S ribosomal protein L27

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00062: ribosomal protein bL27
  • amino acids 1 to 83 (83 residues), 142.6 bits, E=1.5e-46
• PF01016: Ribosomal_L27
  • amino acids 2 to 82 (81 residues), 134 bits, E=7.9e-44

Best Hits

Swiss-Prot: 96% identical to RL27_ERWT9: 50S ribosomal protein L27 (rpmA) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K02899, large subunit ribosomal protein L27 (inferred from 94% identity to spt:SPA3170)

MetaCyc: 92% identical to 50S ribosomal subunit protein L27 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L27p" in subsystem Ribosome LSU bacterial

Protein Sequence (85 amino acids)

>IAI47_17095 50S ribosomal protein L27 (Pantoea sp. MT58)
MAHKKAGGSTRNGRDSNAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGTNVGCGRDHTLF
ATADGKVQFEVKGPNNRKYISIVAE