Protein Info for IAI47_17050 in Pantoea sp. MT58

Annotation: preprotein translocase subunit SecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00810: preprotein translocase, SecG subunit
  • amino acids 3 to 74 (72 residues), 90.6 bits, E=2.5e-30
• PF03840: SecG
  • amino acids 5 to 72 (68 residues), 76.8 bits, E=5.8e-26

Best Hits

Swiss-Prot: 80% identical to SECG_ECOL6: Protein-export membrane protein SecG (secG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03075, preprotein translocase subunit SecG (inferred from 99% identity to pva:Pvag_3674)

MetaCyc: 80% identical to Sec translocon subunit SecG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit SecG (TC 3.A.5.1.1)" in subsystem Murein hydrolase regulation and cell death (TC 3.A.5.1.1)

Protein Sequence (112 amino acids)

>IAI47_17050 preprotein translocase subunit SecG (Pantoea sp. MT58)
MYEALLVVFLIVAIALVGMIMLQQGKGADMGASFGAGASGTVFGSSGSGNFMTRTTGILA
ALFFIISLVLGNLNSNKASKGSEWENLSAPAQSSQQTEKPAQPVTPGSDIPK