Protein Info for IAI47_17025 in Pantoea sp. MT58

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 897 PF04760: IF2_N" amino acids 1 to 52 (52 residues), 41.8 bits, see alignment 2.6e-14 amino acids 321 to 371 (51 residues), 56.7 bits, see alignment 5.9e-19 PF08364: IF2_assoc" amino acids 60 to 95 (36 residues), 60.5 bits, see alignment (E = 4.8e-20) TIGR00487: translation initiation factor IF-2" amino acids 313 to 896 (584 residues), 968.1 bits, see alignment E=1.9e-295 TIGR00231: small GTP-binding protein domain" amino acids 399 to 555 (157 residues), 118.4 bits, see alignment E=2.8e-38 PF00009: GTP_EFTU" amino acids 400 to 556 (157 residues), 120.5 bits, see alignment E=2.4e-38 PF01926: MMR_HSR1" amino acids 401 to 506 (106 residues), 39.9 bits, see alignment E=1.5e-13 PF00071: Ras" amino acids 402 to 557 (156 residues), 24.3 bits, see alignment E=7.5e-09 PF11987: IF-2" amino acids 672 to 786 (115 residues), 146.9 bits, see alignment E=8.7e-47 PF03144: GTP_EFTU_D2" amino acids 817 to 884 (68 residues), 35.4 bits, see alignment 4.2e-12

Best Hits

Swiss-Prot: 87% identical to IF2_CITK8: Translation initiation factor IF-2 (infB) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 88% identity to eay:EAM_3071)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (897 amino acids)

>IAI47_17025 translation initiation factor IF-2 (Pantoea sp. MT58)
MTDVTVKSLAAEIQTPVDRLVQQFADAGIPKSENDAVSQQEKETLLSHLNREHGQVGSAK
LTLQRKTRSTLNIPGTGGKSKSVQIEVRKKRTYVKGDAESEQAQAEAEAEAQREAEEQAQ
REAEEKARREAEQKAQREAEDKARREAADKAKRAAAENDKVTNQPTDEVTKAAQSDKARR
EAEAAELKRKAEEEARRKLEEAARLVAEEARRLAEEKSAEWEKPEEEDKGDYHVTTSTHA
RQAEDENDRQVEAGRARARTTAKAARPAKKGNKHSEAKTDREEARAQVRGGKGGKHRKPS
ALQQGFNKPAQAVNRDVVIGETITVAELANKMAVKGSLVIKAMMKMGAMATINQVIDQET
AQLVAEEMGHKVTLRRENELEEAVMDDRDTDAAQESRAPVVTIMGHVDHGKTSLLDYIRS
TKIASGEAGGITQHIGAYHVETDNGMVTFLDTPGHAAFTAMRARGAQATDIVILVVAADD
GVMPQTVEAIQHAKAAKVPVVVAVNKCDKPEADPDRVKNELTQYGIIPEEWGGENMFVNV
SAKAGTGIDDLLNAILLQAEVLELTAIREGMASGVVIESFLDKGRGPVATVLVREGTLNK
GDIVLCGFEYGRVRAMRDELGREVMEAGPSIPVEILGLSGVPAAGDEATVVRDEKKAREV
ALYRQGKFREVKLARQQKSKLENMFANMTEGEVSELNIVLKADVQGSVEAISDSLQKLST
DEVKVKIVGSGVGGITETDATLAAASNAILLGFNVRADASARRVIDAESLDLRYYSVIYN
LIDEVKAAMSGMLAPEYKQQIIGLAAVRDVFKSPKFGAIAGCMVTEGNIKRHNPIRVLRD
NVVIYEGELESLRRFKDDVNEVRNGMECGIGVKNYNDVRVGDMIEVFEIIEIKRTIE