Protein Info for IAI47_16940 in Pantoea sp. MT58

Annotation: type 1 glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01965: DJ-1_PfpI
  • amino acids 3 to 167 (165 residues), 190.3 bits, E=3.5e-60
• TIGR01382: intracellular protease, PfpI family
  • amino acids 4 to 171 (168 residues), 200.4 bits, E=7.4e-64
• PF00117: GATase
  • amino acids 59 to 126 (68 residues), 24.4 bits, E=3.2e-09
• PF07722: Peptidase_C26
  • amino acids 60 to 115 (56 residues), 20.5 bits, E=5.3e-08

Best Hits

Swiss-Prot: 76% identical to YHBO_ECOLI: Protein/nucleic acid deglycase 2 (yhbO) from Escherichia coli (strain K12)

KEGG orthology group: K05520, protease I [EC: 3.2.-.-] (inferred from 97% identity to pva:Pvag_3695)

MetaCyc: 76% identical to protein/nucleic acid deglycase 2 (Escherichia coli K-12 substr. MG1655)
GLYOXIII-RXN [EC: 4.2.1.130]; RXN-17632 [EC: 4.2.1.130, 3.5.1.124]

Predicted SEED Role

"General stress protein 18"

MetaCyc Pathways

• methylglyoxal degradation IX (1/1 steps found)

KEGG Metabolic Maps

• Glycosaminoglycan degradation

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.- or 3.5.1.124 or 4.2.1.130

Protein Sequence (173 amino acids)

>IAI47_16940 type 1 glutamine amidotransferase (Pantoea sp. MT58)
MSKKVAVLITDEFEDSEFTSPAEVYKRAGFEVVTIEKQAGNVVKGKQGEAEVTIDRSIDD
VSPAEFDALLLPGGHSPDALRGDDRFVAFTKEFVASGKPIFAICHGPQLLISANGVRGRK
MTTVKAVAIDLINAGADFHDKEVVVDGDKLVTSRTPHDLPAFNRESLRILEAL