Protein Info for IAI47_16900 in Pantoea sp. MT58

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 66 to 389 (324 residues), 243.2 bits, see alignment E=1.7e-76 PF16576: HlyD_D23" amino acids 86 to 308 (223 residues), 55.2 bits, see alignment E=1.2e-18 PF13533: Biotin_lipoyl_2" amino acids 86 to 133 (48 residues), 49.4 bits, see alignment 6.2e-17 PF13437: HlyD_3" amino acids 197 to 298 (102 residues), 35.9 bits, see alignment E=2.2e-12

Best Hits

Swiss-Prot: 49% identical to MDTA_PANAA: Multidrug resistance protein MdtA (mdtA) from Pantoea ananatis (strain AJ13355)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 96% identity to pva:Pvag_3704)

MetaCyc: 44% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>IAI47_16900 efflux RND transporter periplasmic adaptor subunit (Pantoea sp. MT58)
MTHLSRPGRTFGLKWLLLLLVVAIVAGVIWRLLTAGHGPGEGMPPGRHGAHGMMGGGATL
VHSGMASTADVPVWLNALGTVIPNASVTVTSRVDGQLEQVFFTEGQKVSAGQLLAQIDPR
SYQATLNQYQGELSENQALLNSAELTLARYRKLAAQDALARQDLDSQIATVGQYRGAVAA
DQAQIASAKLSIEYARITAPISGRVGLRQIDPGNMVQSASSTGLVTITQMQPAAVTFSVP
QSDIPALVSVLHQGQSLPATLFDQDNQHQLASGEVKFISNQIDTATGTVALKAVFANQDE
SLFANQFVNLRLQLRVLKGATVIPAQALQLSSDGSFVFVINQDHTVTRKAVTTGPTFGDD
QQAILSGVSPGDRLVTEGIDRLTSGSKVTLADETPAAGAVSK