Protein Info for IAI47_16890 in Pantoea sp. MT58

Annotation: efflux RND transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1033 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 337 to 353 (17 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 387 to 410 (24 residues), see Phobius details amino acids 431 to 454 (24 residues), see Phobius details amino acids 463 to 489 (27 residues), see Phobius details amino acids 531 to 550 (20 residues), see Phobius details amino acids 858 to 877 (20 residues), see Phobius details amino acids 884 to 904 (21 residues), see Phobius details amino acids 909 to 934 (26 residues), see Phobius details amino acids 957 to 976 (20 residues), see Phobius details amino acids 988 to 1014 (27 residues), see Phobius details PF00873: ACR_tran" amino acids 4 to 1014 (1011 residues), 1021 bits, see alignment E=0 PF02355: SecD_SecF" amino acids 338 to 482 (145 residues), 25.2 bits, see alignment E=1e-09

Best Hits

KEGG orthology group: K07789, RND superfamily, multidrug transport protein MdtC (inferred from 81% identity to ebi:EbC_35940)

Predicted SEED Role

"Acriflavin resistance protein" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1033 amino acids)

>IAI47_16890 efflux RND transporter permease subunit (Pantoea sp. MT58)
MNLTRLFIFRPVATLLLTLAILLLGALGYRLLPVAPLPQVDFPTIMVSASLAGASPETMA
ATVATPLERSLGQIAGISEMTSSSSQGSSTVILQFDLDRDINGAARDVQAAINAARSLLP
SAMASLPTYRKANPSDAPIVMLALTSATRSPGELYDLAESKIEQVMGQVQGVGEVSLMGS
ALPAVRIDLQPLKLTHYGISLETVRAAVANSTTNLPKGILQSSDQSWLVDSNGQLEKAAS
YRDLIITWQQGKAVRLRDVATVYDSVEDRYQAGFLNATPAVMIGIKRQAGANMLETIDAI
KAQLPLLEKSLPADSQLKVVVDRSPGVRASLYDTEETLLIAVLLVIAVVFIFLRNLQAVI
IPALALPVSLIGTCAVMYLLGYSLDNLSLMALIVSTGFVVDDAIVVLENITRHIERGLSP
LRAALRGAQEVSFTVLSMTVSLIAVFIPILLMGSIVGRLFREFAVTLTVSLLISLFVSLS
LTPMLCARLLKPKPPVSQRPHPLYQFIENQLNRLLAAYGRGLAWVMRHQKLTLLSLLLTV
LLNVFLFTVVQKGFFPNQDTGLLMGALRADQNISFQAMKPKMLMFTKIIQKDPAVESVMS
SMGSGMFGSRNSANFFVRLKDFSQRDATATEVANRLTRKTSHIAGAQMFLMAAQDLHIGG
RSANATYQYSLQADDLALLRVWTPKVQAALAAIPQLNSVDSDSQTGGQEVELTIDRDRAT
RLGVNVKMLDTLLNNAFSQRQIATLYHTLNQYHVVMSLQDSDTANPATLQQLYVINDSGD
RVPLSAFVRFSGGNAPLSVAHQGQSATSTVAFNLNDGVSLEQAQLLIKQAMAKLGLPSTI
HAGFAGTAAAFSQLTATMPWLILAALAAVYIVLGVLYESYIHPLTILSTLPSAGVGAMLL
LLLTNTQLTVIALIGIILLIGIVKKNAIMMIDFAIDAERRLGMSPQQAITQACLMRFRPI
MMTTLAAFFGALPLALGSGGDADLRSPLGIAIAGGLALSQLLTLFTTPVVYLWLDRLGRA
TQRQWRRLRPAES