Protein Info for IAI47_16875 in Pantoea sp. MT58

Annotation: lysophospholipid transporter LplT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 29 to 35 (7 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 194 to 211 (18 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 283 to 300 (18 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 343 (326 residues), 68.2 bits, see alignment E=3.2e-23

Best Hits

Swiss-Prot: 78% identical to LPLT_SALNS: Lysophospholipid transporter LplT (lplT) from Salmonella newport (strain SL254)

KEGG orthology group: K08227, MFS transporter, LPLT family, lysophospholipid transporter (inferred from 98% identity to pva:Pvag_3709)

MetaCyc: 78% identical to lysophospholipid transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-294; TRANS-RXN-295; TRANS-RXN-387

Predicted SEED Role

"Lysophospholipid transporter LplT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>IAI47_16875 lysophospholipid transporter LplT (Pantoea sp. MT58)
MSLDRNAPLMSRSMIAVIIAQFFSAFGDNALLFATLAVLKSQFYPDWSQPVLQMLFVAAY
ILLAPFVGQVADSMAKGRVMMLANSLKLLGALVICFGFNPFIGYTLVGAGAAAYSPAKYG
ILGEITHGEKLVKANGLMEASTIAAILLGSVAGGMLADWHILAALGICALTYGIAVVANL
FIPKLQAARPGQSWQFGVMVRSFFSAAALLWRDAETRFSLLGTSLFWGAGVTLRFLLVLW
VPVALGINDNTTPTTLNAMVAIGIVIGAAAAAKLVTLETVRRCMPAGVLIGVMVVVFALQ
HSLLNAYLVLMLIGALGGFFVVPLNALLQARGKESVGSGNAIAVQNLGENSAMLIMLGLY
TLAIKAGAPAVATGVGFGVLFALAIAVLWLWRPAKR