Protein Info for IAI47_16845 in Pantoea sp. MT58

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00658: ornithine carbamoyltransferase
  • amino acids 8 to 332 (325 residues), 437.7 bits, E=1.1e-135
• PF02729: OTCace_N
  • amino acids 8 to 148 (141 residues), 158.5 bits, E=1.3e-50
• PF00185: OTCace
  • amino acids 157 to 330 (174 residues), 181.5 bits, E=1.2e-57

Best Hits

Swiss-Prot: 81% identical to OTCC_ECOL6: Ornithine carbamoyltransferase, catabolic (arcB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 82% identity to ecv:APECO1_2144)

MetaCyc: 68% identical to ornithine carbamoyltransferase ArgI (Escherichia coli K-12 substr. MG1655)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
• urea cycle (3/5 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (2/6 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.3

Use Curated BLAST to search for 2.1.3.3

Protein Sequence (334 amino acids)

>IAI47_16845 ornithine carbamoyltransferase (Pantoea sp. MT58)
MPVSLHNRHFLKLLDFSRTEIQFLIDLSFSLKKAKYSGHEEQKLIGKNIALIFEKTSTRT
RCAFEVAAFDQGAKVTYLGPSGSQIGHKESMKDTARVLGRMYDGIEYRGFGQQIVEELAA
FAGVPVWNGLTNEFHPTQILADLMTMLEHAPGKQLHQIAFAYLGDARNNMGNSLMVGAAK
MGMDIRLVAPRSFWPEEELVAQCRELAKESGARIVLTEDVAEGVAGVDFLYTDVWVSMGE
SKDAWAERVALMTPYQVNAAVLKATQSPQVKFMHCLPAFHNEQTQTGREIEMAYGLKGLE
VTDDVFESSHSIVFDQAENRMHTIKSVMVATLGS