Protein Info for IAI47_16840 in Pantoea sp. MT58

Annotation: carbamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00696: AA_kinase
  • amino acids 5 to 276 (272 residues), 81 bits, E=5.6e-27
• TIGR00746: carbamate kinase
  • amino acids 6 to 302 (297 residues), 362.9 bits, E=6e-113

Best Hits

Swiss-Prot: 54% identical to ARCC_SYNY3: Carbamate kinase (arcC) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00926, carbamate kinase [EC: 2.7.2.2] (inferred from 70% identity to enc:ECL_00670)

Predicted SEED Role

"Carbamate kinase (EC 2.7.2.2)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or MLST or Polyamine Metabolism (EC 2.7.2.2)

MetaCyc Pathways

• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• allantoin degradation IV (anaerobic) (3/9 steps found)
• guadinomine B biosynthesis (2/13 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutamate metabolism
• Nitrogen metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.2

Protein Sequence (307 amino acids)

>IAI47_16840 carbamate kinase (Pantoea sp. MT58)
MKKPLLVVALGGNALLKRGEPLEADVQRRNIEQAAEAIAALTAEWRVILVHGNGPQVGLL
ALQNSACDAAAPYPLDILVAETQGMIGYLLQQALQNHLPDVQISMLLTQVEIAVSDPAFL
NPTKYIGPVYSPQQARQLAKEQGWTMKADGEYVRRVVPSPLPVHIVEHEAILALTELGHL
VICNGGGGIPVIRNQQGQRHGAEAVIDKDLSSALLATQLSADALLILTDADAVYLNWGKA
DCRALHHVTPADLLGIPFDAGSMGPKIAAACEFVTQRAGIAGIGSLADATEILRGHKGTL
IATHSTK