Protein Info for IAI47_16815 in Pantoea sp. MT58

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 9 to 145 (137 residues), 36.8 bits, E=1.5e-12
• PF00583: Acetyltransf_1
  • amino acids 41 to 144 (104 residues), 73 bits, E=6.4e-24
• PF13673: Acetyltransf_10
  • amino acids 57 to 149 (93 residues), 33.1 bits, E=1.2e-11
• PF13508: Acetyltransf_7
  • amino acids 59 to 145 (87 residues), 54.9 bits, E=2.4e-18
• PF08445: FR47
  • amino acids 82 to 148 (67 residues), 30.3 bits, E=8.5e-11

Best Hits

Swiss-Prot: 69% identical to YJGM_SALTY: Uncharacterized N-acetyltransferase YjgM (yjgM) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03828, putative acetyltransferase [EC: 2.3.1.-] (inferred from 90% identity to pva:Pvag_3718)

MetaCyc: 69% identical to O-acetyl-serine N-acetyltransferase, OatA (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-39

Predicted SEED Role

"Aspartate N-acetyltransferase (EC 2.3.1.17)" (EC 2.3.1.17)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.17

Protein Sequence (167 amino acids)

>IAI47_16815 GNAT family N-acetyltransferase (Pantoea sp. MT58)
MTPETQPSLIIRPITVADNPHIAQVIRDVSAEFGLTADKGYTVSDPQLDHLFELYSADQS
AYWIIEYQGKVVGGGGVAPLACSAPDICELQKMYFLPEVRGQGLARELALRAMEHARGHG
FRRCYLETTASLTRAIKLYESLGFEHIDSAMGCTGHVDCEVRMLKQL