Protein Info for IAI47_16790 in Pantoea sp. MT58

Annotation: LPS export ABC transporter permease LptF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 2 to 348 (347 residues), 383.6 bits, see alignment E=3.3e-119 PF03739: LptF_LptG" amino acids 5 to 345 (341 residues), 261.6 bits, see alignment E=5.2e-82

Best Hits

Swiss-Prot: 76% identical to LPTF_ECO57: Lipopolysaccharide export system permease protein LptF (lptF) from Escherichia coli O157:H7

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 92% identity to pam:PANA_0498)

MetaCyc: 76% identical to lipopolysaccharide transport system protein LptF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-237 [EC: 7.5.2.5]

Predicted SEED Role

"FIG000988: Predicted permease"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>IAI47_16790 LPS export ABC transporter permease LptF (Pantoea sp. MT58)
MIIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGEVPTNLVLTLLGLGVPQMA
QLILPLSLFLAILMTLGRLYTESEITVMHACGLSKAVLVKAAMILMLFTSVVAAVNVIWL
GPWSSRYQDEVTQNAKANPGAAAMAAGQFQTSGDGSAVLFVENVKGNNFGNVFLAQLRPK
GNARPSVVLADSGHLEQRKDGSQVVTLDKGTRFEGTALLRDFRITDFTNYQAIVGYKAAT
LDPNDSEQASLSDLVANKTPDFQAELHWRLTLVFAVLVMALMVVPLSVVNPRQGRVLSML
PAMLLYLIFFLLQSSLKSSGAKGRLDPALWMWVVNISYLVLAVLLNLWDTVPMRRIRARF
TRGGSV