Protein Info for IAI47_16765 in Pantoea sp. MT58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 77 to 77 (1 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 260 to 291 (32 residues), see Phobius details amino acids 303 to 320 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 52 to 316 (265 residues), 131.8 bits, see alignment E=1.4e-42

Best Hits

Swiss-Prot: 42% identical to RBSC_HAEIN: Ribose import permease protein RbsC (rbsC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 99% identity to pva:Pvag_3728)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>IAI47_16765 ABC transporter permease (Pantoea sp. MT58)
MNLSSSRMAQHSLPRRLLHNHSGVVSIALFFVFCCVVFSLITGNFLSSANWLNIIRQSAP
LLIVATAMTLVITTGGIDLSVGSTLALVGALSAIALNNWGLPWPVVLLGGLLLGALVGAI
NGFFIAYEGIPAFIVTLATLAVVRGVALLITQGYSIPIPADSLFAFMGRAWVLGVPMPAL
IGIVVLVVGHIVLNHMRFGRYVTAIGANAEGARRSGINTKAVTMKVYIISGMAAALAGMI
ITARLGSGSSNQGEGFELQVIAAVVLGSTSLFGGFGTVVGTLLGALSIAIIQNGLILSHI
SPFYTQIATGTIILLAIWLNTRILNPTRSAAKG