Protein Info for IAI47_16755 in Pantoea sp. MT58

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00356: LacI" amino acids 12 to 56 (45 residues), 45.2 bits, see alignment 1.3e-15 PF00532: Peripla_BP_1" amino acids 68 to 333 (266 residues), 129.8 bits, see alignment E=2.9e-41 PF13407: Peripla_BP_4" amino acids 71 to 316 (246 residues), 51.7 bits, see alignment E=1.8e-17 PF13377: Peripla_BP_3" amino acids 177 to 336 (160 residues), 119.9 bits, see alignment E=2.5e-38

Best Hits

Swiss-Prot: 31% identical to PURR_ALISL: HTH-type transcriptional repressor PurR (purR) from Aliivibrio salmonicida (strain LFI1238)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 94% identity to pva:Pvag_3730)

Predicted SEED Role

"regulatory protein, LacI:Periplasmic binding protein/LacI transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>IAI47_16755 LacI family DNA-binding transcriptional regulator (Pantoea sp. MT58)
MADDMSKKRVLLSDVAALAGLSKATVSRYMNQSIILPQETIDRIEAAIRQLDYRGNSLAR
RLSKGGSETLGLVLPDITNPFFAELADAAEEAASAHGYSLVLCITRNHPGKESQFIRWLD
TCQVDGLLFTTNHPDNGLLRKEINRHQRIVLLDEDIPGSVVPKVFADNVQGGRIATENLI
AAGHRHIAFVGGPDELMSVRERYQGFCTAMEQAGLHVLPEWVMYGEYQREFGKQALERLF
SCAERPTAVFAASDFLVLGLMDGLRARGLKAPEALSLVGFDDATYADFTLPRISTIRQPA
RELGRTAVEIMLRILNDDLSIPAETRLPVEWVARDSIQIC