Protein Info for IAI47_16750 in Pantoea sp. MT58

Annotation: substrate-binding domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 36 to 244 (209 residues), 58.9 bits, see alignment E=8.8e-20 PF13407: Peripla_BP_4" amino acids 40 to 290 (251 residues), 190.3 bits, see alignment E=7.3e-60 PF13377: Peripla_BP_3" amino acids 159 to 304 (146 residues), 37.7 bits, see alignment E=3.5e-13

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 95% identity to pam:PANA_0509)

Predicted SEED Role

"Ribose ABC transporter, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)" in subsystem Bacterial Chemotaxis (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>IAI47_16750 substrate-binding domain-containing protein (Pantoea sp. MT58)
MMAFNTRKLRAVALATGLLSAGSLFSLAQAASTYALVQINQQALFFNQMNKGAQEAAKAS
GKNLVIFNANDNPVSQNDAIENYIQQGVKGIMVDAIDVNGIMPAIKEAAAAKIPVIAIDA
VLPAGPQAAQVGVDNLEGGKIIGKYFVDYVAKDMGGKARLGIVGALNSAVQNQRQKGFEE
TIKSNPGITVADVVDGQNVQDTAMTAAENLITGNPDLTAIYATGEPALLGAIAAVENQGR
QKEIKVFGWDLTSKAISGIDGGYVTAVLQQDPKKMGEEAVKALNALTSGKTVAKTILVPA
TVVTKTNVDSYRAMFK