Protein Info for IAI47_16425 in Pantoea sp. MT58

Annotation: MHS family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 74 to 99 (26 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 359 to 383 (25 residues), see Phobius details amino acids 403 to 423 (21 residues), see Phobius details amino acids 429 to 447 (19 residues), see Phobius details PF07690: MFS_1" amino acids 40 to 389 (350 residues), 95.1 bits, see alignment E=4.1e-31 PF00083: Sugar_tr" amino acids 78 to 456 (379 residues), 105.9 bits, see alignment E=2.4e-34

Best Hits

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_0021)

Predicted SEED Role

"Putative transmembrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>IAI47_16425 MHS family MFS transporter (Pantoea sp. MT58)
MTAHNSVKQQASLSSTSAADERFDTPSGRKDFWRATFSCWLGTAMEYADFALYGLAAGII
FGDVFFPESTPAMALLSSFATWSVGFVARPIGALFFGWLGDRKGRKVVMISTIILMGAST
TFIGLIPGYASIGVWAPACLVLLRFTQGFGAGAELSGGTVMLGEYAPTERRGLVSSVIAL
GSNSGTLLASLVWLLVVQMDQQSLLEWGWRIPFLSSALIALVALWIRRHLRETPVFERRK
AEMEAERAGMKAASVVDQRPFFQRTRAFWTMVGLRIGENGPSYLAQGFIVGYVAKVLMVD
KSVPTTAVFLASLLGFLIIPLAGWLSDRFGRRIVYRVFCLLLMFYAWPAFTLLDTREPML
VIPVIVVGMALASLGIFGVQAAWGVEMFGVHHRYTKMAVAKELGSILSGGTAPLVAAAML
SYTGHWWPIAVYFSAMAAIGFFTTFVAPETRGRNLNLPEDAI