Protein Info for IAI47_16375 in Pantoea sp. MT58

Annotation: 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF08468: MTS_N" amino acids 8 to 162 (155 residues), 184.5 bits, see alignment E=3.6e-58 PF05175: MTS" amino acids 167 to 333 (167 residues), 201.7 bits, see alignment E=1.6e-63 PF13649: Methyltransf_25" amino acids 200 to 297 (98 residues), 32.4 bits, see alignment E=3.1e-11

Best Hits

Swiss-Prot: 77% identical to RSMC_ERWT9: Ribosomal RNA small subunit methyltransferase C (rsmC) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 98% identity to pva:Pvag_0031)

MetaCyc: 74% identical to 16S rRNA m2G1207 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11576 [EC: 2.1.1.172]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>IAI47_16375 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC (Pantoea sp. MT58)
MSAFTPASEVILRHSDEFTARHVLFAGDLQDDLPAQLETASSRVHTQQYHHWQNLSRRMG
EQARYGMVAQPEDVQGCDTLVYFWTKNKPEVQFQLENLLSMLPVGCDVFVVGENRSGVRS
AEGMLESWVKLEKIDSARRCGLYHGRLDKQPAFDASTFGHQYQLDGLTIHTLPGVFSRDG
LDSGSALLLSTFTPHTKGKVLDMGCGAGVIAASLPARSPKVRLWLCDVHAAAIEASKLTL
AANGIEGEVFASNVFSDVTGRFDMIISNPPFHEGTQTSLDAAQALIRGAVKHLNTGGELR
IVANTFLPYPQVLDEAFGSHEVIAQTGRFKVYRAVYGRGAKTR