Protein Info for IAI47_16250 in Pantoea sp. MT58

Annotation: inosine/xanthosine triphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01931: NTPase_I-T
  • amino acids 7 to 166 (160 residues), 170.6 bits, E=1.2e-54
• TIGR00258: inosine/xanthosine triphosphatase
  • amino acids 7 to 167 (161 residues), 171 bits, E=1.2e-54

Best Hits

Swiss-Prot: 83% identical to NCPP_ERWT9: Inosine/xanthosine triphosphatase (ETA_06920) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: None (inferred from 99% identity to pva:Pvag_0056)

MetaCyc: 63% identical to inosine/xanthosine triphosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-5073 [EC: 3.6.1.73]; 3.6.1.73 [EC: 3.6.1.73]

Predicted SEED Role

"Inosine/xanthosine triphosphatase (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.73

Protein Sequence (172 amino acids)

>IAI47_16250 inosine/xanthosine triphosphatase (Pantoea sp. MT58)
MYHVVAATTNPAKIHAIAQAFSDVFGEGSCHIEGVEVDSGVAAQPLTHLETRTGARQRVM
NARQVRPEAAFWVAIEAGIEDDSAFAWMVVENQKQRGESRSASFTLPPVVLAGLREGREL
GEEMARLTGIDNIKHKGGAIGAFTNGLLSRSSVYHQALILALCPFVHPLYQQ