Protein Info for IAI47_16165 in Pantoea sp. MT58

Annotation: Na+/H+ antiporter NhaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details amino acids 39 to 39 (1 residues), see Phobius details transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 214 to 245 (32 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 13 to 387 (375 residues), 491.7 bits, see alignment E=6.8e-152 TIGR00773: Na+/H+ antiporter NhaA" amino acids 14 to 387 (374 residues), 550.6 bits, see alignment E=9.1e-170

Best Hits

Swiss-Prot: 73% identical to NHAA_ERWT9: Na(+)/H(+) antiporter NhaA (nhaA) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03313, Na+:H+ antiporter, NhaA family (inferred from 89% identity to pam:PANA_0665)

MetaCyc: 69% identical to Na+:H+ antiporter NhaA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-129; TRANS-RXN-292

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>IAI47_16165 Na+/H+ antiporter NhaA (Pantoea sp. MT58)
MNKPRSLKNLLKSFIESDASNGMVLIMAAVAAMILANSAETAHGYQAFLNEPVQIRFGAL
DISKNLLLWINDALMALFFLLIGLEVKRELIVGELASRDKAIFPVIAALGGMALPALVFL
GFNHGDEIARNGWAIPTATDIAFALGVLALLGSRVPAALKVFLMALAIIDDLGAIVIIAL
FYTSGLSMLSLGVAAGAIVVLALLNYFNVRKISVYMLVGIVLWTAVLKSGVHATLAGVIV
GFFIPLEKREGHSPAEHLAHGLMPWVNWLILPLFAFANAGISLTGITLSDVFSPEPSGII
LGLLIGKPLGITLFCWLAVKLRLAVLPHGTTIRDIMAIGVLCGIGFTMSIFISSLAFDSA
HEQLVTFSKLGILTGSVLSAVIGYTLLRIKLR