Protein Info for IAI47_16140 in Pantoea sp. MT58

Annotation: signal peptidase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 5 to 160 (156 residues), 179.2 bits, see alignment E=2.8e-57 PF01252: Peptidase_A8" amino acids 16 to 157 (142 residues), 142.5 bits, see alignment E=5.3e-46

Best Hits

Swiss-Prot: 77% identical to LSPA_ERWT9: Lipoprotein signal peptidase (lspA) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 98% identity to pva:Pvag_0078)

MetaCyc: 68% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>IAI47_16140 signal peptidase II (Pantoea sp. MT58)
MRKPILSTGLRWLWLVLVVIVVDFASKQWVMNNMMLHETQPLMPYLNLFYAHNYGAAFSF
LADKGGWQRWFFAGIALAIVISLVVMMYRNHASQKMANIAYALIIGGAIGNLFDRSYHGF
VVDFIDFYVGNWHFATFNIADCGICIGAALVVLEGFFSPNGKQAKQKG