Protein Info for IAI47_16040 in Pantoea sp. MT58

Annotation: thiamine ABC transporter ATP-binding protein ThiQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01277: thiamine ABC transporter, ATP-binding protein
  • amino acids 2 to 213 (212 residues), 335.7 bits, E=5.4e-105
• PF00005: ABC_tran
  • amino acids 18 to 157 (140 residues), 127.2 bits, E=7.4e-41
• PF13304: AAA_21
  • amino acids 118 to 190 (73 residues), 33.1 bits, E=5.9e-12

Best Hits

Swiss-Prot: 67% identical to THIQ_SALPA: Thiamine import ATP-binding protein ThiQ (thiQ) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K02062, thiamine transport system ATP-binding protein (inferred from 97% identity to pva:Pvag_0100)

MetaCyc: 66% identical to thiamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-32-RXN [EC: 7.6.2.15]

Predicted SEED Role

"Thiamin ABC transporter, ATPase component / Thiamine transport ATP-binding protein thiQ" in subsystem Thiamin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.15

Protein Sequence (233 amino acids)

>IAI47_16040 thiamine ABC transporter ATP-binding protein ThiQ (Pantoea sp. MT58)
MLTLDNLTYLYQHLPMRFSLKATRGERIAILGPSGAGKSTLLSLIAGFLPVKQGTLMIDG
QDHTHSVPARRPVSMLFQENNLFPHLSVQQNMALGLHPGLKLSAEQRQQLAALADQVGLG
DLLNRLPGELSGGQRQRVALARCLLRDRPVLLLDEPFSALDPALRGEMLQLVRSVCEARS
ITLLMVSHSLEDARQIAPRSVVIVDGRVYWDGETRQLLSGDTREAEVLGIPRR