Protein Info for IAI47_16020 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 307 to 329 (23 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 303 (285 residues), 119.1 bits, see alignment E=3.3e-38 PF12832: MFS_1_like" amino acids 23 to 352 (330 residues), 26.9 bits, see alignment E=3.8e-10

Best Hits

Swiss-Prot: 69% identical to SETA_ECOLI: Sugar efflux transporter A (setA) from Escherichia coli (strain K12)

KEGG orthology group: K03291, MFS transporter, SET family, sugar efflux transporter (inferred from 97% identity to pva:Pvag_0104)

MetaCyc: 69% identical to sugar exporter SetA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-82

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>IAI47_16020 MFS transporter (Pantoea sp. MT58)
MKSLLTRQRRINPVYLAFMVASFMLGIAGALQAPTLSLFLTREVQARPFWVGLFFTINAV
AGIVVSMLVAKRSDSVGDRRHIILFCCLMALVNALLFAFTRDYLTLLTLGVLLSALASVS
MPQLFALAREYADQSAREAVMFSSVMRAQLSLAWVIGPPLSFALALNYGFVTLFMVAAVL
FLLCILLVWFTLPSVPRSQPLMQSGGLPLSGWRDRDVRLLFLASVAMWTCNTMYIIDMPL
YISTTLGLPEKLAGLLMGTAAGLEIPVMLLAGHYARRIGKRRLMLIAVAAGVLFYLGLVL
FNSRTSLMVLQLFNAVFVGIIAGIGMLWFQDLMPGRPGAATTMFTNSISTGMILAGVIQG
TLSERLGHEAVYWLAFGLAIVALVMSARVRDV