Protein Info for IAI47_15920 in Pantoea sp. MT58

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 4 to 305 (302 residues), 344.8 bits, E=2e-107
• PF01820: Dala_Dala_lig_N
  • amino acids 56 to 86 (31 residues), 36.3 bits, see alignment (E = 1.1e-12)
• PF07478: Dala_Dala_lig_C
  • amino acids 103 to 303 (201 residues), 222.5 bits, E=6.4e-70
• PF02786: CPSase_L_D2
  • amino acids 128 to 274 (147 residues), 22.1 bits, E=1.5e-08

Best Hits

Swiss-Prot: 71% identical to DDL_ERWT9: D-alanine--D-alanine ligase (ddl) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 96% identity to pva:Pvag_0123)

MetaCyc: 67% identical to D-alanine--D-alanine ligase B (Escherichia coli K-12 substr. MG1655)
D-alanine--D-alanine ligase. [EC: 6.3.2.4]

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (12/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.4

Use Curated BLAST to search for 6.3.2.4

Protein Sequence (306 amino acids)

>IAI47_15920 D-alanine--D-alanine ligase (Pantoea sp. MT58)
MADKVAVLMGGTSAEREVSLNSGQAVIAGLREMGINAHGIDTRHVSVLTLKEQGFTKAFI
ALHGRGGEDGTMQAVLEFLQLPYTGSGVMASAVTMDKLRTKLLWQGRGLPSGKFVWLTRQ
QFEGGLDEESNAAIAALGLPLFVKPACEGSSVGISRVNDLHALPAALEMAFKYDNDVLVE
AFLSGAEYTVAIVGDRILPSIEIKSASEFYDYEAKYISDDTQYVCPAELSAEREAELQQL
VLAAWRALGCRGWGRVDVMTDGEGRFQLLEANTSPGMTSHSLVPMAAKQAGMSFPQLVAH
ILELAD