Protein Info for IAI47_15895 in Pantoea sp. MT58

Annotation: secA regulator SecM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 signal peptide" amino acids 20 to 20 (1 residues), see Phobius details amino acids 38 to 42 (5 residues), see Phobius details transmembrane" amino acids 21 to 37 (17 residues), see Phobius details PF06558: SecM" amino acids 30 to 170 (141 residues), 149.6 bits, see alignment E=3.2e-48

Best Hits

Swiss-Prot: 58% identical to SECM_ERWT9: Secretion monitor (secM) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K13301, secretion monitor (inferred from 94% identity to pva:Pvag_0129)

Predicted SEED Role

"Secretion monitor precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>IAI47_15895 secA regulator SecM (Pantoea sp. MT58)
MRDGKVVIGILQRWRQLGRRYFWPHLLLGMVAASFGLPACAQSAEPNASSESPASSLFLG
NATRFDHLIRLQEASRRPSFSVDYWHQHAIRTVIRHLSFTLAPQAQAEQQQLPLAAQKLA
LIDSLHNLLTSHSALHTAPQQMATPPLFMAVTRSWVEWHASVHGIRAGPARLFC