Protein Info for IAI47_15860 in Pantoea sp. MT58

Annotation: protein transport protein HofC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 166 to 186 (21 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details PF00482: T2SSF" amino acids 65 to 187 (123 residues), 92.2 bits, see alignment E=1.3e-30 amino acids 274 to 390 (117 residues), 90.1 bits, see alignment E=5.6e-30

Best Hits

KEGG orthology group: K02505, protein transport protein HofC (inferred from 92% identity to pva:Pvag_0137)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>IAI47_15860 protein transport protein HofC (Pantoea sp. MT58)
MANASLFSWQAVDSQGQLLSGQLLAIDSDNLLLMLAQRDLLPVSWKREKVWRPRDWKWQH
KTDLIRQLATLLKAGLPLAESLVLLAEGQPHAGWRALMLALHHRVLSGAPFSQALREWPQ
IFPALYPSLMEVGELTGQLDVCCSELAQQQIRQQQLWHQVGKALRYPLFILLVAMAVTCG
MLLFVLPEFVAVYDAFDAPLPAFTAAVMQLSAALQEWGGVLTLGVSLMLTGWHQLRRRSE
GWQRREQAFFLRIPLLSGLWRGTQLTQIYTILHLTQSAGLTLLQGLSAVKVTLSSLLWRD
AIAGLQQHIAEGSPLHQALMQHPLFTPLCGQLIRVGEEAGALDLMLARLAEWHEAETRER
ADTLAASLEPMMMMVIGGIVGTLVIAMYLPVFGLGDAMH