Protein Info for IAI47_15820 in Pantoea sp. MT58

Annotation: aromatic amino acid transporter AroP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 194 to 218 (25 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 398 to 419 (22 residues), see Phobius details amino acids 425 to 444 (20 residues), see Phobius details PF00324: AA_permease" amino acids 17 to 450 (434 residues), 442.6 bits, see alignment E=1.7e-136 PF13520: AA_permease_2" amino acids 21 to 431 (411 residues), 123.6 bits, see alignment E=1e-39

Best Hits

Swiss-Prot: 84% identical to AROP_ECOLI: Aromatic amino acid transport protein AroP (aroP) from Escherichia coli (strain K12)

KEGG orthology group: K11734, aromatic amino acid transport protein AroP (inferred from 99% identity to pva:Pvag_0145)

MetaCyc: 84% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Phenylalanine-specific permease" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>IAI47_15820 aromatic amino acid transporter AroP (Pantoea sp. MT58)
MEQQQGEALKRGLKNRHIQLIALGGAVGTGLFLGSASVIESAGPAVILGYAIAGFIAFLI
MRQLGEMVVEEPVAGSFSHFAYKYWGNFAGFASGWNYWVLYVLVAMAELTAVGKYVQFWW
PDFPTWASAALFFVMINAINLTNVKVFGEMEFWFAIIKVVAVIGMILFGGWLLFSGHAGP
QATVRNLWEQGGFFPHGIGGLVTVMAIIMFSFGGLELVGITAAEADNPEVSIPKATNQVL
WRILIFYIGSLAVLLSLMPWTRVTSEVSPFVFIFHELGDAMVANALNVVILTAALSVYNS
CVYCNSRMLFGLAQQGNAPKALLKVDRRGVPVLTILVSAVATALCVLINYLMPGEAFGLL
MSLVVSALVINWAMISLAHLKFRRKKDQQGVTTRFKALLYPAGNWICLIFLAGILVLMAT
TPGMAISVWLIPVWLVILGIGYFIKNQTQKA