Protein Info for IAI47_15665 in Pantoea sp. MT58

Annotation: aspartate 1-decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02261: Asp_decarbox
  • amino acids 1 to 114 (114 residues), 155.3 bits, E=2.7e-50
• TIGR00223: aspartate 1-decarboxylase
  • amino acids 1 to 125 (125 residues), 192.5 bits, E=1.1e-61

Best Hits

Swiss-Prot: 89% identical to PAND_ERWT9: Aspartate 1-decarboxylase (panD) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01579, aspartate 1-decarboxylase [EC: 4.1.1.11] (inferred from 98% identity to pam:PANA_0764)

MetaCyc: 79% identical to aspartate 1-decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Aspartate 1-decarboxylase (EC 4.1.1.11)" in subsystem Coenzyme A Biosynthesis (EC 4.1.1.11)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• β-alanine biosynthesis III (1/1 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Pantothenate and CoA biosynthesis
• beta-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.11

Protein Sequence (126 amino acids)

>IAI47_15665 aspartate 1-decarboxylase (Pantoea sp. MT58)
MIRTVLQGKLHRVKVTQADLNYEGSCAIDQDFLDASGILQYEAIDIYNVTNGQRFSTYAI
AAERGSKIISVNGAAARCACEGDILIICSYVQVEDAEARQWLPKVAYFEGDNQMKRLAKA
LPVQIA