Protein Info for IAI47_15645 in Pantoea sp. MT58

Annotation: polynucleotide adenylyltransferase PcnB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 TIGR01942: poly(A) polymerase" amino acids 39 to 469 (431 residues), 501.8 bits, see alignment E=7.6e-155 PF01743: PolyA_pol" amino acids 70 to 203 (134 residues), 138.5 bits, see alignment E=2.4e-44 PF12627: PolyA_pol_RNAbd" amino acids 230 to 290 (61 residues), 69.5 bits, see alignment E=2.6e-23 PF12626: PolyA_pol_arg_C" amino acids 348 to 467 (120 residues), 131.7 bits, see alignment E=2.1e-42

Best Hits

Swiss-Prot: 80% identical to PCNB_ECOL6: Poly(A) polymerase I (pcnB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 99% identity to pva:Pvag_0181)

MetaCyc: 80% identical to poly(A) polymerase I (Escherichia coli K-12 substr. MG1655)
Polynucleotide adenylyltransferase. [EC: 2.7.7.19]

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>IAI47_15645 polynucleotide adenylyltransferase PcnB (Pantoea sp. MT58)
MPLSRCPIFTRVANFCRKVLKRDEEEAPAEVEPERLMTIIPRESHTISRKDISENALKVL
YRLNKAGYEAYLVGGGVRDLLLGQKPKDFDVTTNATPEQMRKLFRNCRLVGRRFRLAHVM
FGPEVIEVATFRGHHQVEEIAEDRNSSQRAQSGMLLRDNIFGSIEDDAQRRDLTINSLYY
SVADFSVRDYVGGISDLEQGIIRLIGDPETRYREDPVRMLRVARFAAKLNMRIAPETAEP
IPRLASLLRDIPPARLFEESLKLLQAGYGYSTYLKLCEYQLFQPLFPTLARNFTENSDSH
MERMLAQVLKNTDNRIHNDMRVNPAFLFAAMFWYPQLEAAERIAQESGLTYFEAFAMAMN
DTLDEACRALAIPKRITSLIRDIWLLQLRMSRRHGKRAWKLMEHPKFRAAYDLLALRAEV
ENNPELLRLSQWWGEFQVAAPPHQKNMLNNLGDDPVPRNKSRRPRRRPSAPRRDNQNAS