Protein Info for IAI47_15600 in Pantoea sp. MT58

Annotation: Fe(3+)-hydroxamate ABC transporter substrate-binding protein FhuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01497: Peripla_BP_2
  • amino acids 34 to 264 (231 residues), 120.6 bits, E=3.7e-39

Best Hits

Swiss-Prot: 56% identical to FHUD_ECOLI: Iron(3+)-hydroxamate-binding protein FhuD (fhuD) from Escherichia coli (strain K12)

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 78% identity to pam:PANA_0777)

MetaCyc: 56% identical to iron(III) hydroxamate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-11-RXN [EC: 7.2.2.16]; TRANS-RXN-297 [EC: 7.2.2.16]; TRANS-RXN-298 [EC: 7.2.2.16]

Predicted SEED Role

"Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), periplasmic substrate binding protein FhuD" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin (TC 3.A.1.14.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.16

Protein Sequence (292 amino acids)

>IAI47_15600 Fe(3+)-hydroxamate ABC transporter substrate-binding protein FhuD (Pantoea sp. MT58)
MPDLYRRRLLLALAASPLFCALPLRAATPNPGRIIALEWLPTELLIALGVTPWGVADLHN
YNIWVGEPPLPADVIDVGLRTEPNLELMAQMQPSLILCSNGYGPPEEKLTRIAPIMGFDL
HSGDGKPFTAARASLRKLAARLGLRDRAEQHLREVDAQLAQARQRLAPYAGRTILLMSLL
DSRHAITFGKNSLFLEVMTLLGLKNGWQGETNFWGSAVIGIEQLAQAGNVDVICFDHDND
AEMQQLMRSPLWQAMPFVRTGRFQRVPAVWYYGATLSALHFVRVLERALETH