Protein Info for IAI47_15595 in Pantoea sp. MT58

Annotation: Fe(3+)-hydroxamate ABC transporter permease FhuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 56 to 77 (22 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 277 to 298 (22 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details amino acids 423 to 442 (20 residues), see Phobius details amino acids 448 to 468 (21 residues), see Phobius details amino acids 480 to 499 (20 residues), see Phobius details amino acids 520 to 541 (22 residues), see Phobius details amino acids 544 to 562 (19 residues), see Phobius details amino acids 568 to 594 (27 residues), see Phobius details amino acids 606 to 627 (22 residues), see Phobius details amino acids 636 to 655 (20 residues), see Phobius details PF01032: FecCD" amino acids 14 to 322 (309 residues), 230.8 bits, see alignment E=1.1e-72 amino acids 382 to 657 (276 residues), 228.2 bits, see alignment E=6.7e-72

Best Hits

Swiss-Prot: 66% identical to FHUB_SALTY: Iron(3+)-hydroxamate import system permease protein FhuB (fhuB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 96% identity to pva:Pvag_0190)

MetaCyc: 65% identical to iron(III) hydroxamate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-11-RXN [EC: 7.2.2.16]; TRANS-RXN-297 [EC: 7.2.2.16]; TRANS-RXN-298 [EC: 7.2.2.16]

Predicted SEED Role

"Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), permease component FhuB" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin (TC 3.A.1.14.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (659 amino acids)

>IAI47_15595 Fe(3+)-hydroxamate ABC transporter permease FhuB (Pantoea sp. MT58)
MRHALFPAGLLSLLFLLSLSLTLVNLHHALPQHEWWQAFWSPTVDSLPQMVFHYSLLPRT
ALALLVGAGLGLAGLLFQQILRNPLAEPTTLGVSSGAQLGITVATLWHLPGGALTQQFAA
LGGALLVAALVFGVAWGKRLSPVTLILAGLVLSFYSGAVNQIFAIFNHDQLQNMFLWSTG
ALNQMSWENVQQLWPRLLLAFLLALALLRPLTLMGLDDGVAKNLGLALSVARIGGLGLAI
LLSAQLVNVAGIIGFIGLFAPLLAKLLGGRRLLSRMLLAPLTGALLLWLADSCVLWLSAH
WRDIPTGTATALLGVPILLWLLPRLRTGSVPPALNQGDNVPAERQNLLRWTLTGLAVLAL
LVWGALAFGRDALGWVGSSGEMLHSLLPWRAPRVLAALVTGLMLGVAGSLIQRLTGNPMA
SPEVLGISSGAACGVVVMMFFVPGDAMAWLLPAGAMGAALTLLVIMAVASRGGFSPERML
LAGMALNSAFVTLLMLLLASGDPRMGGLLSWISGSTYNISGSQAIQSALCALLLVSLAPL
ASRWLTLLPLGSATARSAGMALTPARLSLLLLAAALTASATLTIGPLSFVGLMAPHMARM
LGFRRALPQLLLSGLLGAGLMVLADWCGRMLAFPDQIPAGLMATFLGAPYFIWLLRRSG