Protein Info for IAI47_15575 in Pantoea sp. MT58

Annotation: vitamin B12 ABC transporter substrate-binding protein BtuF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01497: Peripla_BP_2
  • amino acids 24 to 215 (192 residues), 64.1 bits, E=6.7e-22

Best Hits

Swiss-Prot: 58% identical to BTUF_PECAS: Vitamin B12-binding protein (btuF) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K06858, vitamin B12 transport system substrate-binding protein (inferred from 94% identity to pva:Pvag_0193)

MetaCyc: 53% identical to vitamin B12 ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-5-RXN [EC: 7.6.2.8]; 7.6.2.8 [EC: 7.6.2.8]

Predicted SEED Role

"Vitamin B12 ABC transporter, B12-binding component BtuF" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.8

Protein Sequence (264 amino acids)

>IAI47_15575 vitamin B12 ABC transporter substrate-binding protein BtuF (Pantoea sp. MT58)
MAKTLLFCWLLLLSGSLLASPPRVITLAPHLTELAFAAGITPIAVSAWSDYPPQAKQIEQ
VANWQGIKAERILQLKPDLVLAWRGGNPQRQIEQLQQLGVPIKWIDPLTLDEMFTALADL
GRWSPRPEQAASAARALRQQAAALRQRYTHLTAVPLFLQFGQQPLFTAARATLQNEVITL
CGGRNIFADSRVSWPQVSREQVLMRHPQAVVIAGGAQQAENIRAFWRPQLTVPVIAINED
WLSRPGPRLLLAAQQLCSALHPAQ