Protein Info for IAI47_15515 in Pantoea sp. MT58

Annotation: ribosome recycling factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR00496: ribosome recycling factor" amino acids 11 to 185 (175 residues), 265.7 bits, see alignment E=7.9e-84 PF01765: RRF" amino acids 20 to 183 (164 residues), 230.8 bits, see alignment E=4.1e-73

Best Hits

Swiss-Prot: 88% identical to RRF_SALTI: Ribosome-recycling factor (frr) from Salmonella typhi

KEGG orthology group: K02838, ribosome recycling factor (inferred from 98% identity to pva:Pvag_0205)

Predicted SEED Role

"Ribosome recycling factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>IAI47_15515 ribosome recycling factor (Pantoea sp. MT58)
MINDIKKDADTRMEKCVEAFKTTISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVE
DSRTLKINVFDRSLSPAVEKAIMKSDLGLNPSSAGTDIRVPLPALTEERRKDLIKIVRGE
AEQGRVSVRNVRRDANDKIKALLKDKEISEDDERRAQDEVQKMTDAYIKKVDAALSEKES
ELMDF