Protein Info for IAI47_15465 in Pantoea sp. MT58

Annotation: lipid-A-disaccharide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00215: lipid-A-disaccharide synthase
  • amino acids 3 to 379 (377 residues), 559.2 bits, E=2e-172
• PF02684: LpxB
  • amino acids 8 to 376 (369 residues), 467.2 bits, E=1.8e-144

Best Hits

Swiss-Prot: 87% identical to LPXB_ERWT9: Lipid-A-disaccharide synthase (lpxB) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K00748, lipid-A-disaccharide synthase [EC: 2.4.1.182] (inferred from 98% identity to pva:Pvag_0215)

MetaCyc: 85% identical to lipid A disaccharide synthase (Escherichia coli K-12 substr. MG1655)
Lipid-A-disaccharide synthase. [EC: 2.4.1.182]

Predicted SEED Role

"Lipid-A-disaccharide synthase (EC 2.4.1.182)" in subsystem KDO2-Lipid A biosynthesis (EC 2.4.1.182)

MetaCyc Pathways

• superpathway of (Kdo)₂-lipid A biosynthesis (17/17 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (19/25 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.182

Protein Sequence (382 amino acids)

>IAI47_15465 lipid-A-disaccharide synthase (Pantoea sp. MT58)
MSARPLTIALVAGETSGDILGAGLIRALKVRHPDARFVGVAGPLMQAEGCEAWYEMEELA
VMGIVEVLGRLRRLLTIRRDLTRRFSELRPDVFVGIDAPDFNITLEGNLKRTGIRTIHYV
SPSVWAWRQKRVFKIGRNTDLVLAFLPFEKAFYDRYNVPCRFIGHTMADAMPLQPDKQAA
RRHLGIADDALCLALLPGSRGAEVEMLSADFLKTAQLLRRHYPALEIVVPLVNARRREQF
EKIKADVAPELPMHLLDGQGREAMIASDAALLASGTAALECMLAKCPMVVGYRMKPATYW
LAKRLVKTPYVSLPNLLAGRELVKELLQDACQPDALAAALDPLLHAGPERETLLQTFHEL
HQQIRWNADEQAADAVLELVNA