Protein Info for IAI47_15325 in Pantoea sp. MT58

Annotation: DNA polymerase III subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family
  • amino acids 6 to 225 (220 residues), 302 bits, E=2.2e-94
• TIGR01406: DNA polymerase III, epsilon subunit
  • amino acids 7 to 242 (236 residues), 314.8 bits, E=3.5e-98
• PF00929: RNase_T
  • amino acids 9 to 175 (167 residues), 142 bits, E=1.4e-45

Best Hits

Swiss-Prot: 82% identical to DPO3E_SALTI: DNA polymerase III subunit epsilon (dnaQ) from Salmonella typhi

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 99% identity to pva:Pvag_0243)

MetaCyc: 79% identical to DNA polymerase III subunit epsilon (Escherichia coli K-12 substr. MG1655)
3.1.11.-

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Protein Sequence (243 amino acids)

>IAI47_15325 DNA polymerase III subunit epsilon (Pantoea sp. MT58)
MSTANNRQIVLDTETTGMNMIGVHYEGHRIIEIGAVEVINRRLTGNNFHMYLKPDRLVDP
EAFGVHGIADEFLADKPAFSDIADEFLDYIRGAELVIHNAPFDIGFMDYEFSKLNRGIEK
TETFCKITDSLALARRMFPGKRNSLDALCSRYEIDNTKRTLHGALLDAEILAEVFLTMTG
GQTSLSFLSESESAREAQGESIQRIVRPASALRVVTASEEEVVAHESRLDLVMKKGGSCL
WRG