Protein Info for IAI47_15260 in Pantoea sp. MT58

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 11 to 106 (96 residues), 85.1 bits, see alignment E=1.9e-28 PF00528: BPD_transp_1" amino acids 43 to 211 (169 residues), 52.7 bits, see alignment E=2.4e-18

Best Hits

Swiss-Prot: 32% identical to YECS_ECOLI: L-cystine transport system permease protein YecS (yecS) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 99% identity to pva:Pvag_0256)

MetaCyc: 32% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Putative amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>IAI47_15260 amino acid ABC transporter permease (Pantoea sp. MT58)
MTTFTDWDILRNLLLAARWTLLLSLVAFAGGTLVTLPLLFLRLLQRKWLTRVIRGYTALF
QGTPLLMQLFLAFFGVGLFGIDVAPWTAASLALTFYTSAFLVDIWYGSIRALPKGQWEAS
RCLGLTFGQTLWRVVAPQAIRIGIAPTVGFAVQVIKGTALASIIGFIELTKAGTILNNVT
YQPFKVFGLVALGYFLMCYPLSRYSQYLEKKFNAAHHH