Protein Info for IAI47_15245 in Pantoea sp. MT58

Annotation: allantoate amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 TIGR01879: amidase, hydantoinase/carbamoylase family" amino acids 27 to 409 (383 residues), 375.7 bits, see alignment E=1.4e-116 PF04389: Peptidase_M28" amino acids 66 to 147 (82 residues), 25.1 bits, see alignment E=2e-09 PF01546: Peptidase_M20" amino acids 82 to 410 (329 residues), 73.3 bits, see alignment E=3.9e-24 PF07687: M20_dimer" amino acids 216 to 312 (97 residues), 26.9 bits, see alignment E=6.1e-10

Best Hits

KEGG orthology group: K02083, allantoate deiminase [EC: 3.5.3.9] (inferred from 97% identity to pva:Pvag_0259)

Predicted SEED Role

"N-carbamoyl-L-amino acid hydrolase (EC 3.5.1.87)" in subsystem Hydantoin metabolism (EC 3.5.1.87)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.87 or 3.5.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>IAI47_15245 allantoate amidohydrolase (Pantoea sp. MT58)
MMMSASEAQAAAQRVMARCDALAAISETAEGLTRVYLSAEHLRANACVGEWMQAAGMQVW
QDEVGNICGRYEAAEAGAPALLLGSHLDTVRNAGRYDGMLGVLSAIETVQWLNEHQRRLP
LAIEVIGFGDEEGTRFGITLLGSRGITGSWPQSWVTHPDGNGITVAQAMADVGLDSDRIA
SAARRVEDIVGYLELHIEQGPCLEQEDLALGVVTAINGARRLNCRFTGEAGHAGTVPMTH
RKDALAAAAEWMVFIEQATREQDPQLVATVGTINCAPGAVNVIPGEVSLSLDVRGPLDNP
LETLLSSLLTQAEAIALRRGLRFESNEYYRIGATACDSVLQQALSHAVETVQGRSLSLPS
GAGHDAIAIAERWPVGMLFVRNHRGISHHPAESVAVDDVAPALQAYLEAVSLIAGRS