Protein Info for IAI47_15075 in Pantoea sp. MT58

Annotation: MCP four helix bundle domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 190 to 212 (23 residues), see Phobius details PF02203: TarH" amino acids 4 to 164 (161 residues), 26.6 bits, see alignment E=1e-09 PF12729: 4HB_MCP_1" amino acids 6 to 170 (165 residues), 77.5 bits, see alignment E=1.9e-25 PF00672: HAMP" amino acids 211 to 261 (51 residues), 41.7 bits, see alignment 2.4e-14 PF00015: MCPsignal" amino acids 326 to 482 (157 residues), 179.2 bits, see alignment E=1.3e-56

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 96% identity to pva:Pvag_0291)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>IAI47_15075 MCP four helix bundle domain-containing protein (Pantoea sp. MT58)
MFSIRNMKVGMRLAAAFGIIVTLLIVIGVTSITRINNINTAISSIVDDRYVKVRLAFDVR
DGVNDQIKYLRGMVIDTTHPENNVKRYGQLDEATQRTNRAMKRIEDIQVTPIGKKKIAGL
LASSQAFEKVKAELITLVKAGNFDAASIYVLKSMTATQNKFLQDAVDFANSQDAQLRTEG
QGIVENGQSAISITLIFSALAILASIMLGYFLTRSIVRPLVAAVDVAERVAAGDLSTQMQ
VTSRDETGVLMQALQRMNDNLLSIVTEVRTGSDTIAVASTQISSGNLDLSTRTEQQASSL
EETASAMEQMTSTVKHNADNAREANHLVSTTSSVAREGGVVMEQVIEKMEAIALSSRKIV
DIISVIDSIAFQTNILSLNAAVEAARAGEQGRGFAVVASEVRNLAQRSASAAKEIKVLIE
DSVAKVDEGSKLVTHAGSTIGEVVNSVQSVANIMSEITIASSEQSSGIHEINQAITQMEA
VTQQNAALVQEASAASQALQDQAERMAQAMSVFNTGKLSVQPVLR