Protein Info for IAI47_15065 in Pantoea sp. MT58

Annotation: chemotaxis protein CheV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF01584: CheW" amino acids 22 to 163 (142 residues), 83.5 bits, see alignment E=1.1e-27 PF00072: Response_reg" amino acids 190 to 309 (120 residues), 52.7 bits, see alignment E=4.5e-18

Best Hits

KEGG orthology group: K03415, two-component system, chemotaxis family, response regulator CheV (inferred from 96% identity to pva:Pvag_0292)

Predicted SEED Role

"Chemotaxis protein CheV (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>IAI47_15065 chemotaxis protein CheV (Pantoea sp. MT58)
MDNFQKEIDERANLALSNKFELLLFRLGSDQLKGKSELFGINVFKLREIVPMQTITKAAG
MSSPLLGMASIRGQFIPVIDLPAVAGCVPETGLNLLLVTEYARNTQAFAVESVDNIVRLD
WSQVHTAEAGIGGRNITSIACLDTDKQGSELAMVLDVEQILYDIIPSSRGVEPEAAKPRA
FNYRPGAVAIVAEDSKVARQLLEQGLKSMGIPALMFNTGLDAWEKIKQLSQEVQASGESI
HDKIALVLTDLEMPEMDGFTLTRNIKRDPILKTLPVVIHSSLSGSANEDHVRKVGADGYV
AKFELNELSDVIFNVLDTAR