Protein Info for IAI47_15030 in Pantoea sp. MT58

Annotation: L-lactate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 118 to 148 (31 residues), see Phobius details amino acids 154 to 179 (26 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 252 to 269 (18 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 330 to 348 (19 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details amino acids 431 to 457 (27 residues), see Phobius details amino acids 468 to 484 (17 residues), see Phobius details amino acids 499 to 515 (17 residues), see Phobius details amino acids 528 to 550 (23 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 6 to 544 (539 residues), 774.9 bits, see alignment E=2.3e-237 PF02652: Lactate_perm" amino acids 16 to 542 (527 residues), 752.8 bits, see alignment E=1.1e-230

Best Hits

Swiss-Prot: 84% identical to LLDP_SALTY: L-lactate permease (lldP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00427, L-lactate permease (inferred from 97% identity to pva:Pvag_0299)

MetaCyc: 84% identical to lactate/glycolate:H+ symporter LldP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-104; TRANS-RXN-105; TRANS-RXN0-515; TRANS-RXN0-622

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (551 amino acids)

>IAI47_15030 L-lactate permease (Pantoea sp. MT58)
MQIWQQNYDPLGNIWLSSLVALIPILFFFFALIKLKMKGYLAATTTVVLALLVALFLYQM
PVAQALAAVGYGFLYGLWPIAWIIVAAVFVYKISVKTGQFDIIRASILSITPDQRLQMLI
VGFSFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIVNTAPVAFGAMGIPIIVA
GQVTGLDSFAIGQMAGRQLPLLTLIVLFWIMAIMDGWRGVKETWPAVVVAGGSFAIAQFL
SSNFLGPELPDIISSLASLVSLTLFLRVWKPVRIFRFADAEAKQGDPLLPPQKYRLGQVI
RAWMPFLFLTATVTLWSIPPFKALFAKGGALYDWVLAVPVPMLNELVARMPPVVSSATPY
PAIYKLDLVSATGTAILIAAIIAMLFLRMKPKAALQTFGETLKELALPIYSIGMVLAFAF
ISNYSGLSATLALALAHTGHAFTFFSPFLGWLGVFLTGSDTSSNALFAALQATTAQQIGV
SDILLVAANTTGGVTGKMISPQSIAIACAAVGLVGKESDLFRFTVKHSLIFTCMVGVITT
LQAYVFPWMIP