Protein Info for IAI47_15025 in Pantoea sp. MT58

Annotation: transcriptional regulator LldR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00392: GntR" amino acids 10 to 65 (56 residues), 61.6 bits, see alignment E=4.4e-21 PF07729: FCD" amino acids 96 to 222 (127 residues), 87.2 bits, see alignment E=1.2e-28

Best Hits

Swiss-Prot: 64% identical to LLDR_ECOLI: Putative L-lactate dehydrogenase operon regulatory protein (lldR) from Escherichia coli (strain K12)

KEGG orthology group: K14348, GntR family transcriptional regulator, L-lactate dehydrogenase operon regulator (inferred from 93% identity to pva:Pvag_0300)

Predicted SEED Role

"Lactate-responsive regulator LldR in Enterobacteria, GntR family" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>IAI47_15025 transcriptional regulator LldR (Pantoea sp. MT58)
MNSHVDPLVMRLRAYITEHQLEPGMRLPAERQLSAELGVSRSSLREAIQQLISSGMLISR
RGGGTWLRQQLAPWSEQRIVEPIRQLLRDDPDYRYDILEARHAIEASTAWHAALRATDSD
KEKLQFAFDATLKLKESDDPDLAAQADVRFHLAIAEASHNVVLLQTMRGFFELLQSSVMQ
TRQRMYTQPAIFGRLTEQHQALLDAILAGDAEAARQSAMHHLGFVHTTMKSLHEDEARQA
RITRLPDNDIRNPKESD