Protein Info for IAI47_14995 in Pantoea sp. MT58

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 867 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF05228: CHASE4" amino acids 72 to 220 (149 residues), 48.6 bits, see alignment E=2.5e-16 TIGR00229: PAS domain S-box protein" amino acids 314 to 435 (122 residues), 48.2 bits, see alignment E=1.1e-16 PF00989: PAS" amino acids 318 to 426 (109 residues), 30.3 bits, see alignment E=9.3e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 437 to 597 (161 residues), 123.8 bits, see alignment E=5.7e-40 PF00990: GGDEF" amino acids 441 to 595 (155 residues), 150.8 bits, see alignment E=7.2e-48 PF00563: EAL" amino acids 615 to 846 (232 residues), 237.2 bits, see alignment E=4.4e-74

Best Hits

KEGG orthology group: None (inferred from 90% identity to pva:Pvag_0305)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (867 amino acids)

>IAI47_14995 EAL domain-containing protein (Pantoea sp. MT58)
MTFNPPAPPALPFRHVAEDRTVRFTRRSLRVLSLLLFGVLALSMLMVLTIAQRQNSVSVE
HDRLLMQQAWKSRQEAMVTDIRDYAFWGEAWQNLHVSVDKVWAFDEENFGPGLYEEYHYE
GVFVVDGKGHTRYSVINGKLVDTPLEAWLGKETSAFIAAARQLNNKAMHRDVLINHLPAI
VVAAPITSGKVRAVTPVAGPPSIMIFVSLFTPEKLKALGTSLDVRELRAPASEEDALREP
RMMLTLPMGDPIVLRWTSKMPGMGLIWFLLPLLMLMAIIIAIITRRVSRHALSNAIISDR
RFAMLAISQQELANSEARFRDLAEAASDWIWETDAEGRLIYLSARFHTVTGHDITHWLGR
HIDHLLTHPSHSLVAWLRRQEEDGQQMPLRCQFMSAHGNRRIGQLVAKTIWHDAKRIGFR
GTVSDITQGMEAEARIQFLSRHDVLTGLSNRMQLLEFLTLHLAITDGSAPLTLVTLDLDQ
FRPINETWGHAAGDEVLSQIAQRLKRCIGPQELVARLSGDEFVLVLREANRERVAQRCAQ
LVHEVQQPISTGQHVHYLTISMGIACAPQDASHPEALLEMADIALNEARDAGRNQWVWYA
NEMTSQREDKREMARRIEKALKNNEFRLHYQPRYQLLTGQLAGAEALIRWQIAPDQWITP
DHFIPLAEESGLIATISDWVLMRACEDALGWGGERYVSVNISPMEFRTSDLVQRVANALE
KSGLPATRLELEITENVTFEHPQHALEIMQGLRSLGVRLTVDDFGTGYAALGYLKTFPFN
GLKIDRSWMKDFPESQQAQSVVAGIIALARAFALTITAEGIETEAQLNQLKQLSCEEGQG
YFLGRPMPLAAFRTLLERTAQNQPEMA